Product Browser

Last updated: 2017/6/25
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TGFA polyclonal antibody (A01)

  • Catalog # : H00007039-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TGFA.
  • Immunogen:
  • TGFA (NP_003227, 42 a.a. ~ 89 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007039-A01
    Western Blot detection against Immunogen (31.39 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7039
  • Gene Name:
  • TGFA
  • Gene Alias:
  • TFGA
  • Gene Description:
  • transforming growth factor, alpha
  • Gene Summary:
  • Transforming growth factors (TGFs) are biologically active polypeptides that reversibly confer the transformed phenotype on cultured cells. TGF-alpha shows about 40% sequence homology with epidermal growth factor (EGF; MIM 131530) and competes with EGF for binding to the EGF receptor (MIM 131550), stimulating its phosphorylation and producing a mitogenic response.[supplied by OMIM
  • Other Designations:
  • transforming growth factor-alpha
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook