TFF3 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TFF3 full-length ORF ( AAH17859.1, 15 a.a. - 73 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
32.23
Interspecies Antigen Sequence
Mouse (78); Rat (76)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TFF3
Entrez GeneID
7033GeneBank Accession#
BC017859Protein Accession#
AAH17859.1Gene Name
TFF3
Gene Alias
HITF, ITF, TFI, hP1.B
Gene Description
trefoil factor 3 (intestinal)
Omim ID
600633Gene Ontology
HyperlinkGene Summary
Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. This gene is expressed in goblet cells of the intestines and colon. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq
Other Designations
intestinal trefoil factor|secretory protein|trefoil factor 3|trefoil factor 3, HITF, human intestinal trefoil factor
-
Interactome
-
Disease
-
Publication Reference
-
Circulating Serum Trefoil Factor 3 (TFF3) Is Dramatically Increased in Chronic Kidney Disease.
Du TY, Luo HM, Qin HC, Wang F, Wang Q, Xiang Y, Zhang Y.
PLoS One 2013 Nov; 8(11):e80271.
Application:S-ELISA, Human, Serum, Urine.
-
Cardioprotective proteins upregulated in the liver in response to experimental myocardial ischemia.
Liu SQ, Tefft BJ, Roberts DT, Zhang LQ, Ren Y, Li YC, Huang Y, Zhang D, Phillips HR, Wu YH.
American Journal of Physiology. Heart and Circulatory Physiology 2012 Oct; 303(12):H1446.
Application:ELISA, Mouse, Mouse serum.
-
Identification of serum biomarkers for colorectal cancer metastasis using a differential secretome approach.
Xue H, Lu B, Zhang J, Wu M, Huang Q, Wu Q, Sheng H, Wu D, Hu J, Lai M.
Journal of Proteome Research 2010 Jan; 9(1):545.
Application:ELISA, Human, Serum.
-
Identification and use of the putative Bacteroides ovatus xylanase promoter for the inducible production of recombinant human proteins.
Hamady ZZ, Farrar MD, Whitehead TR, Holland KT, Lodge JP, Carding SR.
Microbiology 2008 Oct; 154(Pt 10):3165.
Application:EPair-Re, Func, Human, HT-29 cells.
-
Trefoil factor 3: a novel serum marker identified by gene expression profiling in high-grade endometrial carcinomas.
Bignotti E, Ravaggi A, Tassi RA, Calza S, Rossi E, Falchetti M, Romani C, Bandiera E, Odicino FE, Pecorelli S, Santin AD.
British Journal of Cancer 2008 Sep; 99(5):768.
Application:ELISA, Human, Serum.
-
Circulating Serum Trefoil Factor 3 (TFF3) Is Dramatically Increased in Chronic Kidney Disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com