TFF3 monoclonal antibody (M01), clone 3D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant TFF3.
Immunogen
TFF3 (AAH17859.1, 15 a.a. ~ 73 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (76)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.23 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TFF3 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TFF3 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — TFF3
Entrez GeneID
7033GeneBank Accession#
BC017859Protein Accession#
AAH17859.1Gene Name
TFF3
Gene Alias
HITF, ITF, TFI, hP1.B
Gene Description
trefoil factor 3 (intestinal)
Omim ID
600633Gene Ontology
HyperlinkGene Summary
Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. This gene is expressed in goblet cells of the intestines and colon. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq
Other Designations
intestinal trefoil factor|secretory protein|trefoil factor 3|trefoil factor 3, HITF, human intestinal trefoil factor
-
Interactome
-
Disease
-
Publication Reference
-
Circulating Serum Trefoil Factor 3 (TFF3) Is Dramatically Increased in Chronic Kidney Disease.
Du TY, Luo HM, Qin HC, Wang F, Wang Q, Xiang Y, Zhang Y.
PLoS One 2013 Nov; 8(11):e80271.
Application:S-ELISA, Human, Serum, Urine.
-
Reproducibility of histological cell type in high-grade endometrial carcinoma.
Han G, Sidhu D, Duggan MA, Arseneau J, Cesari M, Clement PB, Ewanowich CA, Kalloger SE, Kobel M.
Modern Pathology 2013 Dec; 26(12):1594.
Application:IHC, Human, Clear-cell carcinoma, Endometrial carcinoma, Serous carcinoma.
-
Fresh and cryopreserved amniotic membrane secrete the trefoil factor family peptide 3 that is well known to promote wound healing.
Schulze U, Hampel U, Sel S, Goecke TW, Thäle V, Garreis F, Paulsen F.
Histochemistry and Cell Biology 2012 Aug; 138(2):243.
Application:ELISA, Human, Supernatant from amniotic membrane cell culture medium.
-
Profiling of differentially expressed proteins in stage IV colorectal cancers with good and poor outcomes.
Kim HJ, Kang UB, Lee H, Jung JH, Lee ST, Yu MH, Kim H, Lee C.
Journal of Proteomics 2012 Jun; 75(10):2983.
-
Genetic predisposition directs breast cancer phenotype by dictating progenitor cell fate.
Proia TA, Keller PJ, Gupta PB, Klebba I, Jones AD, Sedic M, Gilmore H, Tung N, Naber SP, Schnitt S, Lander ES, Kuperwasser C.
Cell Stem Cell 2011 Feb; 8(2):149.
Application:IHC, Human, Breast.
-
Calculator for ovarian carcinoma subtype prediction.
Kalloger SE, Kobel M, Leung S, Mehl E, Gao D, Marcon KM, Chow C, Clarke BA, Huntsman DG, Gilks CB.
Modern Pathology 2011 Apr; 24(4):512.
Application:IHC, Human, Ovarian carcinoma.
-
Identification of serum biomarkers for colorectal cancer metastasis using a differential secretome approach.
Xue H, Lu B, Zhang J, Wu M, Huang Q, Wu Q, Sheng H, Wu D, Hu J, Lai M.
Journal of Proteome Research 2010 Jan; 9(1):545.
Application:ELISA, IHC, WB, Human, Serum, CRC tissues, SW480, SW620 cells.
-
Trefoil factor 3: a novel serum marker identified by gene expression profiling in high-grade endometrial carcinomas.
Bignotti E, Ravaggi A, Tassi RA, Calza S, Rossi E, Falchetti M, Romani C, Bandiera E, Odicino FE, Pecorelli S, Santin AD.
British Journal of Cancer 2008 Sep; 99(5):768.
Application:ELISA, Human, Serum.
-
Circulating Serum Trefoil Factor 3 (TFF3) Is Dramatically Increased in Chronic Kidney Disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com