Product Browser

Last updated: 2017/10/15
  • Related Product Showcase
  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TFF2 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00007032-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human TFF2 protein.
  • Immunogen:
  • TFF2 (NP_005414.1, 1 a.a. ~ 129 a.a) full-length human protein.
  • Sequence:
  • MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TFF2 expression in transfected 293T cell line (H00007032-T02) by TFF2 MaxPab polyclonal antibody.

    Lane 1: TFF2 transfected lysate(14.30 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 7032
  • Gene Name:
  • TFF2
  • Gene Alias:
  • SML1,SP
  • Gene Description:
  • trefoil factor 2
  • Gene Summary:
  • Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. The encoded protein inhibits gastric acid secretion. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq
  • Other Designations:
  • spasmolysin,spasmolytic polypeptide,spasmolytic protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook