Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TFE3 polyclonal antibody (A01)

  • Catalog # : H00007030-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TFE3.
  • Immunogen:
  • TFE3 (NP_006512, 166 a.a. ~ 254 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RPPPAQVPREVLKVQTHLENPTRYHLQQARRQQVKQYLSTTLGPKLASQALTPPPGPASAQPLPAPEAAHTTGPTGSAPNSPMALLTIG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007030-A01
    Western Blot detection against Immunogen (35.9 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7030
  • Gene Name:
  • TFE3
  • Gene Alias:
  • RCCP2,TFEA,bHLHe33
  • Gene Description:
  • transcription factor binding to IGHM enhancer 3
  • Gene Summary:
  • TFE3, a member of the helix-loop-helix family of transcription factors, binds to the mu-E3 motif of the immunoglobulin heavy-chain enhancer and is expressed in many cell types (Henthorn et al., 1991 [PubMed 1685140]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000024272,Renal cell carcinoma, papillary,Transcription factor for IgH enhancer,transcription factor E family, member A,transcription factor E3
  • RSS
  • YouTube
  • Linkedin
  • Facebook