Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TFCP2 polyclonal antibody (A01)

  • Catalog # : H00007024-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TFCP2.
  • Immunogen:
  • TFCP2 (AAH03634, 414 a.a. ~ 502 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • KHEDGDSNGTFFVYHAIYLEELTAVELTEKIAQLFSISPCQISQIYKQGPTGIHVLISDEMIQNFQEEACFILDTMKAETNDSYHIILK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007024-A01
    Western Blot detection against Immunogen (35.9 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • TFCP2 polyclonal antibody (A01), Lot # 051003JC01. Western Blot analysis of TFCP2 expression in human ovarian cancer.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7024
  • Gene Name:
  • TFCP2
  • Gene Alias:
  • CP2,LBP-1C,LSF,SEF,TFCP2C
  • Gene Description:
  • transcription factor CP2
  • Other Designations:
  • SAA3 enhancer factor,Transcription factor CP2, alpha globin
  • RSS
  • YouTube
  • Linkedin
  • Facebook