TFAP4 monoclonal antibody (M05), clone 8G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TFAP4.
Immunogen
TFAP4 (NP_003214, 93 a.a. ~ 192 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TFAP4 monoclonal antibody (M05), clone 8G6. Western Blot analysis of TFAP4 expression in Jurkat(Cat # L017V1 ).Western Blot (Transfected lysate)
Western Blot analysis of TFAP4 expression in transfected 293T cell line by TFAP4 monoclonal antibody (M05), clone 8G6.
Lane 1: TFAP4 transfected lysate(38.87 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TFAP4 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TFAP4 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — TFAP4
Entrez GeneID
7023GeneBank Accession#
NM_003223Protein Accession#
NP_003214Gene Name
TFAP4
Gene Alias
AP-4, bHLHc41
Gene Description
transcription factor AP-4 (activating enhancer binding protein 4)
Omim ID
600743Gene Ontology
HyperlinkGene Summary
Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family contain a basic domain, which is used for DNA binding, and HLH and ZIP domains, which are used for oligomerization. Transcription factor AP4 activates both viral and cellular genes by binding to the symmetrical DNA sequence CAGCTG (Mermod et al., 1988 [PubMed 2833704]; Hu et al., 1990 [PubMed 2123466]).[supplied by OMIM
Other Designations
transcription factor AP-4 (activating enhancer-binding protein 4)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com