TFAP4 monoclonal antibody (M01), clone 6B1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TFAP4.
Immunogen
TFAP4 (NP_003214, 93 a.a. ~ 192 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TFAP4 monoclonal antibody (M01), clone 6B1 Western Blot analysis of TFAP4 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TFAP4 on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TFAP4 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TFAP4 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TFAP4
Entrez GeneID
7023GeneBank Accession#
NM_003223Protein Accession#
NP_003214Gene Name
TFAP4
Gene Alias
AP-4, bHLHc41
Gene Description
transcription factor AP-4 (activating enhancer binding protein 4)
Omim ID
600743Gene Ontology
HyperlinkGene Summary
Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family contain a basic domain, which is used for DNA binding, and HLH and ZIP domains, which are used for oligomerization. Transcription factor AP4 activates both viral and cellular genes by binding to the symmetrical DNA sequence CAGCTG (Mermod et al., 1988 [PubMed 2833704]; Hu et al., 1990 [PubMed 2123466]).[supplied by OMIM
Other Designations
transcription factor AP-4 (activating enhancer-binding protein 4)
-
Interactome
-
Disease
-
Publication Reference
-
Transcription factor binding at Ig enhancers is linked to somatic hypermutation targeting.
Dinesh RK, Barnhill B, Ilanges A, Wu L, Michelson DA, Senigl F, Alinikula J, Shabanowitz J, Hunt DF, Schatz DG.
European Journal of Immunology 2020 Mar; 50(3):380.
Application:WB-Ce, Human, Ramos A23 cells.
-
Differential cellular responses by oncogenic levels of c-Myc expression in long-term confluent retinal pigment epithelial cells.
Wang Y, Cheng X, Samma MK, Kung SKP, Lee CM, Chiu SK.
Molecular and Cellular Biochemistry 2017 Nov; [Epub].
Application:WB-Ce, Human, HEK 293T cells.
-
Ectopic AP4 expression induces cellular senescence via activation of p53 in long-term confluent retinal pigment epithelial cells.
Wang Y, Wong MM, Zhang X, Chiu SK.
Experimental Cell Research 2015 Nov; 339(1):135.
Application:WB, Human, RPE cells.
-
Transcription factor binding at Ig enhancers is linked to somatic hypermutation targeting.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com