Product Browser

Last updated: 2017/11/12
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TFAP2C polyclonal antibody (A01)

  • Catalog # : H00007022-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TFAP2C.
  • Immunogen:
  • TFAP2C (NP_003213, 341 a.a. ~ 450 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GRNEMAARKNMLLAAQQLCKEFTELLSQDRTPHGTSRLAPVLETNIQNCLSHFSLITHGFGSQAICAAVSALQNYIKEALIVIDKSYMNPGDQSPADSNKTLEKMEKHRK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007022-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7022
  • Gene Name:
  • TFAP2C
  • Gene Alias:
  • AP2-GAMMA,ERF1,TFAP2G,hAP-2g
  • Gene Description:
  • transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma)
  • Gene Summary:
  • The protein encoded by this gene is a sequence-specific DNA-binding transcription factor involved in the activation of several developmental genes. The encoded protein can act as either a homodimer or heterodimer with other family members and is induced during retinoic acid-mediated differentiation. It plays a role in the development of the eyes, face, body wall, limbs, and neural tube. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031355,estrogen receptor factor 1,transcription factor AP-2 gamma,transcription factor AP-2 gamma (activating enhancer-binding protein 2 gamma)
  • RSS
  • YouTube
  • Linkedin
  • Facebook