TFAP2B polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant TFAP2B.
Immunogen
TFAP2B (NP_003212, 73 a.a. ~ 182 a.a) partial recombinant protein with GST tag.
Sequence
DPYSHVNDPYSLNPLHQPQQHPWGQRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNSGMNLL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — TFAP2B
Entrez GeneID
7021GeneBank Accession#
NM_003221Protein Accession#
NP_003212Gene Name
TFAP2B
Gene Alias
AP-2B, AP2-B, MGC21381
Gene Description
transcription factor AP-2 beta (activating enhancer binding protein 2 beta)
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the AP-2 family of transcription factors. AP-2 proteins form homo- or hetero-dimers with other AP-2 family members and bind specific DNA sequences. They are thought to stimulate cell proliferation and suppress terminal differentiation of specific cell types during embryonic development. Specific AP-2 family members differ in their expression patterns and binding affinity for different promoters. This protein functions as both a transcriptional activator and repressor. Mutations in this gene result in autosomal dominant Char syndrome, suggesting that this gene functions in the differentiation of neural crest cell derivatives. [provided by RefSeq
Other Designations
OTTHUMP00000039925|activating enhancer binding protein 2 beta|transcription factor AP-2 beta
-
Interactome
-
Disease
-
Publication Reference
-
Conditional Deletion of AP-2 alpha in the Developing Retina Demonstrates Non-Cell Autonomo1 us Roles for AP-2 alpha in Optic Cup Development.
Bassett EA, Pontoriero GF, Feng W, Marquardt T, Fini ME, Williams T, West-Mays JA.
Molecular and Cellular Biology 2007 Aug; 27(21):7497.
Application:IF, Mouse, Mouse retina.
-
Conditional Deletion of AP-2 alpha in the Developing Retina Demonstrates Non-Cell Autonomo1 us Roles for AP-2 alpha in Optic Cup Development.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com