TFAP2A (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TFAP2A full-length ORF ( NP_003211.1, 1 a.a. - 437 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
74.5
Interspecies Antigen Sequence
Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TFAP2A
Entrez GeneID
7020GeneBank Accession#
NM_003220.2Protein Accession#
NP_003211.1Gene Name
TFAP2A
Gene Alias
AP-2, AP-2alpha, AP2TF, BOFS, TFAP2
Gene Description
transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)
Omim ID
107580Gene Ontology
HyperlinkGene Summary
AP2-alpha is a 52-kD retinoic acid-inducible and developmentally regulated activator of transcription that binds to a consensus DNA-binding sequence CCCCAGGC in the SV40 and metallothionein (MIM 156350) promoters.[supplied by OMIM
Other Designations
OTTHUMP00000016013|OTTHUMP00000016014|activating enhancer-binding protein 2 alpha|transcription factor AP-2 alpha|transcription factor AP-2 alpha (activating enhancer-binding protein 2 alpha)
-
Interactome
-
Disease
-
Publication Reference
-
DACT2 modulated by TFAP2A-mediated allelic transcription promotes EGFR-TKIs efficiency in advanced lung adenocarcinoma.
Zhang N, Li Y, Xie M, Song Y, Liu J, Lei T, Shen Y, Yu J, Yang M.
Biochemical Pharmacology 2020 Feb; 172:113772.
Application:Func, Probe.
-
DACT2 modulated by TFAP2A-mediated allelic transcription promotes EGFR-TKIs efficiency in advanced lung adenocarcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com