Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TFAP2A polyclonal antibody (A01)

  • Catalog # : H00007020-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TFAP2A.
  • Immunogen:
  • TFAP2A (AAH17754, 99 a.a. ~ 205 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7020
  • Gene Name:
  • TFAP2A
  • Gene Alias:
  • AP-2,AP-2alpha,AP2TF,BOFS,TFAP2
  • Gene Description:
  • transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)
  • Gene Summary:
  • AP2-alpha is a 52-kD retinoic acid-inducible and developmentally regulated activator of transcription that binds to a consensus DNA-binding sequence CCCCAGGC in the SV40 and metallothionein (MIM 156350) promoters.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000016013,OTTHUMP00000016014,activating enhancer-binding protein 2 alpha,transcription factor AP-2 alpha,transcription factor AP-2 alpha (activating enhancer-binding protein 2 alpha)
  • RSS
  • YouTube
  • Linkedin
  • Facebook