TESK1 monoclonal antibody (M01), clone 1D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TESK1.
Immunogen
TESK1 (AAH67130, 266 a.a. ~ 365 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DFGLDVPAFRTLVGDDCPLPFLLLAIHCCNLEPSTRAPFTEITQHLEWILEQLPEPAPLTRTALTHNQGSVARGGPSATLPRPDPRLSRSRSDLFLPPSP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (82)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — TESK1
Entrez GeneID
7016GeneBank Accession#
BC067130Protein Accession#
AAH67130Gene Name
TESK1
Gene Alias
-
Gene Description
testis-specific kinase 1
Omim ID
601782Gene Ontology
HyperlinkGene Summary
This gene product is a serine/threonine protein kinase that contains an N-terminal protein kinase domain and a C-terminal proline-rich domain. Its protein kinase domain is most closely related to those of the LIM motif-containing protein kinases (LIMKs). The encoded protein can phosphorylate myelin basic protein and histone in vitro. The testicular germ cell-specific expression and developmental pattern of expression of the mouse gene suggests that this gene plays an important role at and after the meiotic phase of spermatogenesis. [provided by RefSeq
Other Designations
OTTHUMP00000021332|testis specific kinase-1|testis-specific kinase-1|testis-specific protein kinase 1
-
Interactome
-
Publication Reference
-
Tesk1 interacts with Spry2 to abrogate its inhibition of ERK phosphorylation downstream of receptor tyrosine kinase signaling.
Chandramouli S, Yu CY, Yusoff P, Lao DH, Leong HF, Mizuno K, Guy GR.
The Journal of Biological Chemistry 2007 Nov; 283(3):1679.
Application：WB, Human, Mouse, CHO-K1, HEK 293 cells, Mouse brain, testis.
-
Tesk1 interacts with Spry2 to abrogate its inhibition of ERK phosphorylation downstream of receptor tyrosine kinase signaling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com