Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TEAD3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00007005-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TEAD3 partial ORF ( NP_003205, 215 a.a. - 302 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • WQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWAD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.42
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007005-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7005
  • Gene Name:
  • TEAD3
  • Gene Alias:
  • DTEF-1,ETFR-1,TEAD5,TEF-5,TEF5
  • Gene Description:
  • TEA domain family member 3
  • Gene Summary:
  • This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is predominantly expressed in the placenta and is involved in the transactivation of the chorionic somatomammotropin-B gene enhancer. Translation of this protein is initiated at a non-AUG (AUA) start codon. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000039597,TEA domain family member 5,Transcriptional enhancer factor TEF-5 (DTEF-1),transcriptional enhancer factor 5
  • RSS
  • YouTube
  • Linkedin
  • Facebook