TEAD4 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TEAD4 partial ORF ( NP_003204, 151 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
ARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TEAD4
Entrez GeneID
7004GeneBank Accession#
NM_003213Protein Accession#
NP_003204Gene Name
TEAD4
Gene Alias
EFTR-2, MGC9014, RTEF1, TCF13L1, TEF-3, TEFR-1, hRTEF-1B
Gene Description
TEA domain family member 4
Omim ID
601714Gene Ontology
HyperlinkGene Summary
This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene. [provided by RefSeq
Other Designations
related transcription enhancer factor 1B|transcription factor 13-like 1|transcriptional enhancer factor 1-related|transcriptional enhancer factor 3
-
Interactome
-
Publication Reference
-
TGF-β synergizes with defects in the Hippo pathway to stimulate human malignant mesothelioma growth.
Fujii M, Toyoda T, Nakanishi H, Yatabe Y, Sato A, Matsudaira Y, Ito H, Murakami H, Kondo Y, Kondo E, Hida T, Tsujimura T, Osada H, Sekido Y.
The Journal of Experimental Medicine 2012 Mar; 209(3):479.
Application：IP, Human, HEK 293, Y-MESO-27 cells.
-
TGF-β synergizes with defects in the Hippo pathway to stimulate human malignant mesothelioma growth.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com