Product Browser

Last updated: 2017/11/12

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TEAD4 (Human) Recombinant Protein (Q01)

  • Catalog # : H00007004-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TEAD4 partial ORF ( NP_003204, 151 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007004-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7004
  • Gene Name:
  • TEAD4
  • Gene Alias:
  • EFTR-2,MGC9014,RTEF1,TCF13L1,TEF-3,TEFR-1,hRTEF-1B
  • Gene Description:
  • TEA domain family member 4
  • Gene Summary:
  • This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene. [provided by RefSeq
  • Other Designations:
  • related transcription enhancer factor 1B,transcription factor 13-like 1,transcriptional enhancer factor 1-related,transcriptional enhancer factor 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook