TEAD4 monoclonal antibody (M01J), clone 5H3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TEAD4.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
TEAD4 (NP_003204, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDP
Host
Mouse
Reactivity
Human
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TEAD4 monoclonal antibody (M01J), clone 5H3. Western Blot analysis of TEAD4 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of TEAD4 expression in transfected 293T cell line by TEAD4 monoclonal antibody (M01J), clone 5H3.
Lane 1: TEAD4 transfected lysate (Predicted MW: 34.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of TEAD4 transfected lysate using anti-TEAD4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TEAD4 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TEAD4 is 0.1 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TEAD4 over-expressed 293 cell line, cotransfected with TEAD4 Validated Chimera RNAi ( Cat # H00007004-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TEAD4 monoclonal antibody (M01), clone 5H3 (Cat # H00007004-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — TEAD4
Entrez GeneID
7004GeneBank Accession#
NM_003213Protein Accession#
NP_003204Gene Name
TEAD4
Gene Alias
EFTR-2, MGC9014, RTEF1, TCF13L1, TEF-3, TEFR-1, hRTEF-1B
Gene Description
TEA domain family member 4
Omim ID
601714Gene Ontology
HyperlinkGene Summary
This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene. [provided by RefSeq
Other Designations
related transcription enhancer factor 1B|transcription factor 13-like 1|transcriptional enhancer factor 1-related|transcriptional enhancer factor 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com