TEAD4 monoclonal antibody (M01), clone 5H3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TEAD4.
Immunogen
TEAD4 (NP_003204, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDP
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TEAD4 monoclonal antibody (M01), clone 5H3 Western Blot analysis of TEAD4 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of TEAD4 expression in transfected 293T cell line by TEAD4 monoclonal antibody (M01), clone 5H3.
Lane 1: TEAD4 transfected lysate(34.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of TEAD4 transfected lysate using anti-TEAD4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TEAD4 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TEAD4 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TEAD4 over-expressed 293 cell line, cotransfected with TEAD4 Validated Chimera RNAi ( Cat # H00007004-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TEAD4 monoclonal antibody (M01), clone 5H3 (Cat # H00007004-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — TEAD4
Entrez GeneID
7004GeneBank Accession#
NM_003213Protein Accession#
NP_003204Gene Name
TEAD4
Gene Alias
EFTR-2, MGC9014, RTEF1, TCF13L1, TEF-3, TEFR-1, hRTEF-1B
Gene Description
TEA domain family member 4
Omim ID
601714Gene Ontology
HyperlinkGene Summary
This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene. [provided by RefSeq
Other Designations
related transcription enhancer factor 1B|transcription factor 13-like 1|transcriptional enhancer factor 1-related|transcriptional enhancer factor 3
-
Interactome
-
Publication Reference
-
The YAP1/TAZ-TEAD transcriptional network regulates gene expression at neuromuscular junctions in skeletal muscle fibers.
Lea Gessler, Danyil Huraskin, Yongzhi Jian, Nane Eiber, Zhaoyong Hu, Tomasz J Prószyński, Said Hashemolhosseini.
Nucleic Acids Research 2024 Jan; 52(2):600.
Application:WB, Mouse, Primary muscle cells.
-
Epigenetic silencing of miR-1271 enhances MEK1 and TEAD4 expression in gastric cancer.
Lim B, Kim HJ, Heo H, Huh N, Baek SJ, Kim JH, Bae DH, Seo EH, Lee SI, Song KS, Kim SY, Kim YS, Kim M.
Cancer Medicine 2018 Jun; [Epub].
Application:WB-Tr, Human, MKN1, MKN74, SNU-601 cells.
-
Common and Distinctive Functions of the Hippo Effectors Taz and Yap in Skeletal Muscle Stem Cell Function.
Sun C, De Mello V, Mohamed A, Ortuste Quiroga HP, Garcia-Munoz A, Al Bloshi A, Tremblay AM, von Kriegsheim A, Collie-Duguid E, Vargesson N, Matallanas D, Wackerhage H, Zammit PS.
Stem Cells 2017 Jun; 35(8):1958.
Application:IF, WB, Mouse, C2C12 cells, Mouse satellite cell‐derived myoblasts.
-
Integrative genomics analysis reveals the multilevel dysregulation and oncogenic characteristics of TEAD4 in gastric cancer.
Lim B, Park JL, Kim HJ, Park YK, Kim JH, Sohn HA, Noh SM, Song KS, Kim WH, Kim YS, Kim SY.
Carcinogenesis 2014 May; 35(5):1020.
Application:IHC, Human, Gastric tissue.
-
Induction of a trophoblast-like phenotype by hydralazine in the p19 embryonic carcinoma cell line.
O'Driscoll CM, Coulter JB, Bressler JP.
Biochimica et Biophysica Acta 2013 Mar; 1833(3):460.
Application:ICC, WB-Ce, WB-Tr, Mouse, P19 cells.
-
Transcription factor TEAD4 regulates expression of Myogenin and the unfolded protein response genes during C2C12 cell differentiation.
Benhaddou A, Keime C, Ye T, Morlon A, Michel I, Jost B, Mengus G, Davidson I.
Cell Death Differ 2011 Jun; 19:220.
Application:IF, WB-Ce, WB-Tr, Mouse, C2C12 cells.
-
The YAP1/TAZ-TEAD transcriptional network regulates gene expression at neuromuscular junctions in skeletal muscle fibers.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com