Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Pathway

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TEAD4 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00007004-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human TEAD4 protein.
  • Immunogen:
  • TEAD4 (NP_958851.1, 1 a.a. ~ 305 a.a) full-length human protein.
  • Sequence:
  • MAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TEAD4 expression in transfected 293T cell line (H00007004-T02) by TEAD4 MaxPab polyclonal antibody.

    Lane 1: TEAD4 transfected lysate(33.55 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 7004
  • Gene Name:
  • TEAD4
  • Gene Alias:
  • EFTR-2,MGC9014,RTEF1,TCF13L1,TEF-3,TEFR-1,hRTEF-1B
  • Gene Description:
  • TEA domain family member 4
  • Gene Summary:
  • This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene. [provided by RefSeq
  • Other Designations:
  • related transcription enhancer factor 1B,transcription factor 13-like 1,transcriptional enhancer factor 1-related,transcriptional enhancer factor 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook