PRDX2 monoclonal antibody (M01), clone 4E10-2D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PRDX2 monoclonal antibody (M01), clone 4E10-2D2 Western Blot analysis of PRDX2 expression in Hela ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of PRDX2 expression in transfected 293T cell line by PRDX2 monoclonal antibody (M01), clone 4E10-2D2.
Lane 1: PRDX2 transfected lysate(21.9 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PRDX2 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. [antibody concentration 1 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRDX2 is approximately 1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PRDX2 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (47.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant PRDX2.
Immunogen
PRDX2 (AAH00452, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (47.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PRDX2 monoclonal antibody (M01), clone 4E10-2D2 Western Blot analysis of PRDX2 expression in Hela ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PRDX2 expression in transfected 293T cell line by PRDX2 monoclonal antibody (M01), clone 4E10-2D2.
Lane 1: PRDX2 transfected lysate(21.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PRDX2 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRDX2 is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PRDX2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PRDX2
Entrez GeneID
7001GeneBank Accession#
BC000452Protein Accession#
AAH00452Gene Name
PRDX2
Gene Alias
MGC4104, NKEFB, PRP, PRX2, PRXII, TDPX1, TSA
Gene Description
peroxiredoxin 2
Omim ID
600538Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms. Transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
natural killer-enhancing factor B|thiol-specific antioxidant 1|thioredoxin peroxidase 1|thioredoxin-dependent peroxide reductase 1|torin
-
Interactome
-
Disease
-
Publication Reference
-
Global analysis of erythroid cells redox status reveals the involvement of Prdx1 and Prdx2 in the severity of beta thalassemia.
Romanello KS, Teixeira KKL, Silva JPMO, Nagamatsu ST, Bezerra MAC, Domingos IF, Martins DAP, Araujo AS, Lanaro C, Breyer CA, Ferreira RA, Franco-Penteado C, Costa FF, Malavazi I, Netto LES, de Oliveira MA, Cunha AF.
PLoS One 2018 Dec; 13(12):e0208316.
Application：WB, Human, Erythrocytes of patients with β-thalassemia.
-
Redox sensitivities of global cellular cysteine residues under reductive and oxidative stress.
Araki K, Kusano H, Sasaki N, Tanaka R, Hatta T, Fukui K, Natsume T.
Journal of Proteome Research 2016 Aug; 15(8):2548.
Application：WB-Ce, Human, HEK 293T cells.
-
HDAC2 and TXNL1 distinguish aneuploid from diploid colorectal cancers.
Gemoll T, Roblick UJ, Szymczak S, Braunschweig T, Becker S, Igl BW, Bruch HP, Ziegler A, Hellman U, Difilippantonio MJ, Ried T, Jornvall H, Auer G, Habermann JK.
Cellular and Molecular Life Sciences 2011 Oct; 68(19):3261.
Application：WB, Human, DLD-1, HCT116, LoVo, COLO 201, HT-29, T84, Caco-2 cells.
-
Identification of a New Panel of Serum Autoantibodies Associated with the Presence of In situ Carcinoma of the Breast in Younger Women.
Desmetz C, Bascoul-Mollevi C, Rochaix P, Lamy PJ, Kramar A, Rouanet P, Maudelonde T, Mange A, Solassol J.
Clinical Cancer Research 2009 Jul; 15(14):4733.
Application：ELISA, IHC-P, WB, Human, Breast tissues, Serum.
-
Global analysis of erythroid cells redox status reveals the involvement of Prdx1 and Prdx2 in the severity of beta thalassemia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com