TDO2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
TDO2 MaxPab rabbit polyclonal antibody. Western Blot analysis of TDO2 expression in Jurkat.
Western Blot (Transfected lysate)
Western Blot analysis of TDO2 expression in transfected 293T cell line (H00006999-T03) by TDO2 MaxPab polyclonal antibody.
Lane 1: TDO2 transfected lysate(47.90 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human TDO2 protein.
Immunogen
TDO2 (NP_005642.1, 1 a.a. ~ 406 a.a) full-length human protein.
Sequence
MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TDO2 MaxPab rabbit polyclonal antibody. Western Blot analysis of TDO2 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of TDO2 expression in transfected 293T cell line (H00006999-T03) by TDO2 MaxPab polyclonal antibody.
Lane 1: TDO2 transfected lysate(47.90 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TDO2
Entrez GeneID
6999GeneBank Accession#
NM_005651.1Protein Accession#
NP_005642.1Gene Name
TDO2
Gene Alias
TDO, TPH2, TRPO
Gene Description
tryptophan 2,3-dioxygenase
Omim ID
191070Gene Ontology
HyperlinkGene Summary
Tryptophan 2,3-dioxygenase (EC 1.13.11.11) plays a role in catalyzing the first and rat-limiting step in the kynurenine pathway, the major pathway of tryptophan metabolism.[supplied by OMIM
Other Designations
Tryptophan oxygenase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
TDO2 Was Downregulated in Hepatocellular Carcinoma and Inhibited Cell Proliferation by Upregulating the Expression of p21 and p27.
Chengpeng Yu, Dean Rao, He Zhu, Qiumeng Liu, Wenjie Huang, Long Zhang, Huifang Liang, Jia Song, Zeyang Ding
BioMed Research International 2021 Aug; 2021:4708439.
Application：WB, Human, Human hepatocellular carcinoma, HepG2, HLF cells.
-
Engagement of the Aryl Hydrocarbon Receptor in Mycobacterium tuberculosis-Infected Macrophages Has Pleiotropic Effects on Innate Immune Signaling.
Memari B, Bouttier M, Dimitrov V, Ouellette M, Behr MA, Fritz JH, White JH.
The Journal of Immunology 2015 Nov; 195(9):4479.
Application：WB, Human, Macrophages.
-
Abnormalities of neurotransmitter and neuropeptide systems in human neuroepithelioma cells infected by three Toxoplasma strains.
Xiao J, Li Y, Jones-Brando L, Yolken RH.
Journal of Neural Transmission 2013 Dec; 120(12):1631.
Application：WB-Ce, Human, SK-N-MC cells.
-
TDO2 Was Downregulated in Hepatocellular Carcinoma and Inhibited Cell Proliferation by Upregulating the Expression of p21 and p27.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com