TDO2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human TDO2 protein.
Immunogen
TDO2 (NP_005642.1, 1 a.a. ~ 406 a.a) full-length human protein.
Sequence
MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TDO2 expression in transfected 293T cell line (H00006999-T01) by TDO2 MaxPab polyclonal antibody.
Lane 1: TDO2 transfected lysate(44.66 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TDO2
Entrez GeneID
6999GeneBank Accession#
NM_005651.1Protein Accession#
NP_005642.1Gene Name
TDO2
Gene Alias
TDO, TPH2, TRPO
Gene Description
tryptophan 2,3-dioxygenase
Omim ID
191070Gene Ontology
HyperlinkGene Summary
Tryptophan 2,3-dioxygenase (EC 1.13.11.11) plays a role in catalyzing the first and rat-limiting step in the kynurenine pathway, the major pathway of tryptophan metabolism.[supplied by OMIM
Other Designations
Tryptophan oxygenase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Synthetic Essentiality of Tryptophan 2,3-dioxygenase 2 in APC-Mutated Colorectal Cancer.
Rumi Lee, Jiexi Li, Jun Li, Chang-Jiun Wu, Shan Jiang, Wen-Hao Hsu, Deepavali Chakravarti, Peiwen Chen, Kyle A LaBella, Jing Li, Denise J Spring, Di Zhao, Y Alan Wang, Ronald A DePinho.
Cancer Discovery 2022 Jul; 12(7):1702.
Application:IHC-P, Human, mouse, Human colorestal cancer, mouse colon, colorestal cancer.
-
TDO2 overexpression correlates with poor prognosis, cancer stemness, and resistance to cetuximab in bladder cancer.
Quoc Thang Pham, Daiki Taniyama, Shintaro Akabane, Kenji Harada, Takashi Babasaki, Yohei Sekino, Tetsuraro Hayashi, Naoya Sakamoto, Kazuhiro Sentani, Naohide Oue, Wataru Yasui.
Cancer Reports (Hoboken, N.J.) 2021 Jun; e1417.
Application:IHC-P, WB-Ce, WB-Tr, Human, Human bladder cancer, Human normal urothelium, 253-JBV, KMBC2, RT112, T24, UMUC3, UMUC6, UMUC13 cells.
-
Expression of Tryptophan 2,3-Dioxygenase in Metastatic Uveal Melanoma.
Terai M, Londin E, Rochani A, Link E, Lam B, Kaushal G, Bhushan A, Orloff M, Sato T.
Cancers 2020 Feb; 12(2):E405.
Application:WB-Ce, Human, UM001, UM004, UM0028, UMp005.
-
TDO2 Overexpression Is Associated with Cancer Stem Cells and Poor Prognosis in Esophageal Squamous Cell Carcinoma.
Pham QT, Oue N, Sekino Y, Yamamoto Y, Shigematsu Y, Sakamoto N, Sentani K, Uraoka N, Yasui W.
Oncology 2018 Aug; 1.
Application:IHC-P, WB-Tr, Human, Liver, Esophageal squamous cell carcinoma, TE-11 cells.
-
A TDO2-AhR Signaling Axis Facilitates Anoikis Resistance and Metastasis in Triple-Negative Breast Cancer.
D'Amato NC, Rogers TJ, Gordon MA, Greene LI, Cochrane DR, Spoelstra NS, Nemkov TG, D'Alessandro A, Hansen KC, Richer JK.
Cancer Research 2015 Nov; 75(21):4651.
Application:IHC, WB, Human, BT549, MDA-MB-231, SUM159PT cells.
-
Expression of tryptophan 2,3-dioxygenase in mature granule cells of the adult mouse dentate gyrus.
Ohira K, Hagihara H, Toyama K, Takao K, Kanai M, Funakoshi H, Nakamura T, Miyakawa T.
Molecular Brain 2010 Sep; 3(1):26.
Application:IF, WB-Ti, Mouse, Cerebellum, Dentate gyrus, Hippocampus.
-
Synthetic Essentiality of Tryptophan 2,3-dioxygenase 2 in APC-Mutated Colorectal Cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com