Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DYNLT1 (Human) Recombinant Protein (P01)

  • Catalog # : H00006993-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DYNLT1 full-length ORF (BAG37971.1, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.83
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6993
  • Gene Name:
  • DYNLT1
  • Gene Alias:
  • CW-1,MGC111571,TCTEL1,tctex-1
  • Gene Description:
  • dynein, light chain, Tctex-type 1
  • Gene Summary:
  • Cytoplasmic dynein is the major motor protein complex responsible for minus-end, microtubule-based motile processes. Each dynein complex consists of 2 heavy chains that have ATPase and motor activities, plus a group of accessory polypeptides. TCTEX1 is a dynein light chain involved in cargo binding (Chuang et al., 2005 [PubMed 15992542]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000017508,OTTHUMP00000040084,t-complex-associated-testis-expressed 1-like 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook