Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TRA MaxPab mouse polyclonal antibody (B02)MaxPab

  • Catalog # : H00006955-B02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human TRA protein.
  • Immunogen:
  • TRA (AAH22317, 1 a.a. ~ 296 a.a) full-length human protein.
  • Sequence:
  • MLFSSLLCVFVAFSYSGSSVAQKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGESFLPFRGNFHYTDKLIFGKGTRVTVEPRSQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TRA expression in transfected 293T cell line (H00006955-T01) by TRA MaxPab polyclonal antibody.

    Lane 1: TRA transfected lysate(32.56 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6955
  • Gene Name:
  • TRA
  • Gene Alias:
  • FLJ22602,MGC117436,MGC22624,MGC23964,MGC71411,TCRA,TCRD,TRA
  • Gene Description:
  • T cell receptor alpha locus
  • Other Designations:
  • T-cell antigen receptor, alpha polypeptide,T-cell receptor, alpha (V,D,J,C)
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook