TCOF1 monoclonal antibody (M02), clone 8H3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of TCOF1 expression in transfected 293T cell line by TCOF1 monoclonal antibody (M02), clone 8H3.
Lane 1: TCOF1 transfected lysate(152.104 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TCOF1 is 0.3 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to TCOF1 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (34.65 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TCOF1.
Immunogen
TCOF1 (NP_001008657, 2 a.a. ~ 82 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AEARKRRELLPLIYHHLLRAGYVRAAREVKEQSGQKCFLAQPVTLLDIYTHWQQTSELGRKRKAEEDAALQAKKTRVSDPI
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.65 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TCOF1 expression in transfected 293T cell line by TCOF1 monoclonal antibody (M02), clone 8H3.
Lane 1: TCOF1 transfected lysate(152.104 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TCOF1 is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TCOF1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — TCOF1
Entrez GeneID
6949GeneBank Accession#
NM_001008657Protein Accession#
NP_001008657Gene Name
TCOF1
Gene Alias
MFD1, treacle
Gene Description
Treacher Collins-Franceschetti syndrome 1
Gene Ontology
HyperlinkGene Summary
This gene encodes a nucleolar protein with a LIS1 homology domain. The protein is involved in ribosomal DNA gene transcription through its interaction with upstream binding factor (UBF). Mutations in this gene have been associated with Treacher Collins syndrome, a disorder which includes abnormal craniofacial development. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
Treacher Collins syndrome protein|nucleolar trafficking phosphoprotein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com