MLX purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MLX expression in transfected 293T cell line (H00006945-T02) by MLX MaxPab polyclonal antibody.
Lane 1: MLX transfected lysate(23.54 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MLX protein.
Immunogen
MLX (NP_937848.1, 1 a.a. ~ 214 a.a) full-length human protein.
Sequence
MTEPGASPEDPWVKVEYAYSDNSLDPDDEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (79); Rat (79)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MLX expression in transfected 293T cell line (H00006945-T02) by MLX MaxPab polyclonal antibody.
Lane 1: MLX transfected lysate(23.54 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MLX
Entrez GeneID
6945GeneBank Accession#
NM_198205.1Protein Accession#
NP_937848.1Gene Name
MLX
Gene Alias
MAD7, MXD7, TCFL4, bHLHd13
Gene Description
MAX-like protein X
Omim ID
602976Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
BigMax protein|MAX-like bHLHZIP protein|transcription factor-like 4|transcription factor-like protein 4
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com