TCF19 monoclonal antibody (M01), clone 6D8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
TCF19 monoclonal antibody (M01), clone 6D8 Western Blot analysis of TCF19 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of TCF19 expression in transfected 293T cell line by TCF19 monoclonal antibody (M01), clone 6D8.
Lane 1: TCF19 transfected lysate(37.2 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TCF19 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TCF19 is approximately 0.1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of TCF19 over-expressed 293 cell line, cotransfected with TCF19 Validated Chimera RNAi ( Cat # H00006941-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TCF19 monoclonal antibody (M01), clone 6D8 (Cat # H00006941-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to TCF19 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.2 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TCF19.
Immunogen
TCF19 (NP_009040, 17 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DLYTFHPPAGVGCTYRLGHRADLCDVALRPQQEPGLISGIHAELHAEPRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.2 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TCF19 monoclonal antibody (M01), clone 6D8 Western Blot analysis of TCF19 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of TCF19 expression in transfected 293T cell line by TCF19 monoclonal antibody (M01), clone 6D8.
Lane 1: TCF19 transfected lysate(37.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TCF19 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TCF19 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TCF19 over-expressed 293 cell line, cotransfected with TCF19 Validated Chimera RNAi ( Cat # H00006941-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TCF19 monoclonal antibody (M01), clone 6D8 (Cat # H00006941-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to TCF19 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TCF19
Entrez GeneID
6941GeneBank Accession#
NM_007109Protein Accession#
NP_009040Gene Name
TCF19
Gene Alias
SC1, SC1-1
Gene Description
transcription factor 19 (SC1)
Omim ID
600912Gene Ontology
HyperlinkOther Designations
OTTHUMP00000029412|OTTHUMP00000029413|SC1(TCF19)-6|SC1(TCF19)-7|SCI(TCF19)-4|transcription factor 19
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com