Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TCF19 polyclonal antibody (A01)

  • Catalog # : H00006941-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TCF19.
  • Immunogen:
  • TCF19 (NP_009040, 17 a.a. ~ 102 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DLYTFHPPAGVGCTYRLGHRADLCDVALRPQQEPGLISGIHAELHAEPRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006941-A01
    Western Blot detection against Immunogen (35.57 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6941
  • Gene Name:
  • TCF19
  • Gene Alias:
  • SC1,SC1-1
  • Gene Description:
  • transcription factor 19 (SC1)
  • Other Designations:
  • OTTHUMP00000029412,OTTHUMP00000029413,SC1(TCF19)-6,SC1(TCF19)-7,SCI(TCF19)-4,transcription factor 19
  • RSS
  • YouTube
  • Linkedin
  • Facebook