Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZEB1 monoclonal antibody (M01), clone 4C4

  • Catalog # : H00006935-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant ZEB1.
  • Immunogen:
  • ZEB1 (NP_110378, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • NIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006935-M01
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescence of monoclonal antibody to ZEB1 on U-2 OS cell. [antibody concentration 10 ug/ml]
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged ZEB1 is 3 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Immunofluorescence (Circulating Tumor Cell)
  • Immunofluorescence (Circulating Tumor Cell)
  • U-2 OS cells were stained with ZEB1-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue).
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Immunofluorescence (Circulating Tumor Cell)
  • Immunofluorescence (Circulating Tumor Cell)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6935
  • Gene Name:
  • ZEB1
  • Gene Alias:
  • AREB6,BZP,DELTA-EF1,MGC133261,NIL-2-A,NIL-2A,NIL2A,TCF8,ZEB,ZFHEP,ZFHX1A
  • Gene Description:
  • zinc finger E-box binding homeobox 1
  • Gene Summary:
  • ZEB1 encodes a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene (MIM 147680) expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site (Williams et al., 1991 [PubMed 1840704]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000019405,transcription factor 8 (represses interleukin 2 expression),zinc finger homeodomain enhancer-binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook