TCF3 monoclonal antibody (M01), clone 5G2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TCF3.
Immunogen
TCF3 (NP_003191, 545 a.a. ~ 654 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (92)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TCF3 monoclonal antibody (M01), clone 5G2 Western Blot analysis of TCF3 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TCF3 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — TCF3
Entrez GeneID
6929GeneBank Accession#
NM_003200Protein Accession#
NP_003191Gene Name
TCF3
Gene Alias
E2A, ITF1, MGC129647, MGC129648, bHLHb21
Gene Description
transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47)
Omim ID
147141Gene Ontology
HyperlinkGene Summary
The TCF3 gene, also called E2A, encodes 2 basic helix-loop-helix (bHLH) transcription factors, E12 and E47, through alternative splicing. E12 and E47 are involved in regulation of immunoglobulin gene expression (Bain et al., 1994 [PubMed 8001125]).[supplied by OMIM
Other Designations
E2A immunoglobulin enhancer-binding factor E12/E47|immunoglobulin transcription factor 1|kappa-E2-binding factor|transcription factor 3|transcription factor E2-alpha
-
Interactome
-
Publication Reference
-
Synaptic Cross-talk between N-Methyl-D-aspartate Receptors and LAPSER1-{beta}-Catenin at Excitatory Synapses.
Schmeisser MJ, Grabrucker AM, Bockmann J, Boeckers TM.
The Journal of Biological Chemistry 2009 Oct; 284(42):29146.
Application:IF, Rat, Rat hippocampal neurons.
-
Synaptic Cross-talk between N-Methyl-D-aspartate Receptors and LAPSER1-{beta}-Catenin at Excitatory Synapses.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com