Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HNF1A (Human) Recombinant Protein (Q01)

  • Catalog # : H00006927-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HNF1A partial ORF (P20823, 532 a.a. - 631 a.a.) recombinant protein with GST tag at N-terminal.
  • Sequence:
  • ALASLTPTKQVFTSDTEASSESGLHTPASQATTLHVPSQDPAGIQHLQPAHRLSASPTVSSSSLVLYQSSDSSNGQSHLLPSNHSVIETFISTQMASSSQ
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue

    QC Testing of H00006927-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6927
  • Gene Name:
  • HNF1A
  • Gene Alias:
  • HNF1,LFB1,MODY3,TCF1
  • Gene Description:
  • HNF1 homeobox A
  • Gene Summary:
  • The protein encoded by this gene is a transcription factor required for the expression of several liver-specific genes. The encoded protein functions as a homodimer and binds to the inverted palindrome 5'-GTTAATNATTAAC-3'. Defects in this gene are a cause of maturity onset diabetes of the young type 3 (MODY3) and also can result in the appearance of hepatic adenomas. [provided by RefSeq
  • Other Designations:
  • Interferon production regulator factor (HNF1),albumin proximal factor,hepatic nuclear factor 1,maturity onset diabetes of the young 3,transcription factor 1, hepatic,transcription factor 1, hepatic; LF-B1, hepatic nuclear factor (HNF1), albumin proximal f
  • RSS
  • YouTube
  • Linkedin
  • Facebook