TBX3 monoclonal antibody (M02), clone 8H3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
TBX3 monoclonal antibody (M02), clone 8H3. Western Blot analysis of TBX3 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
TBX3 monoclonal antibody (M02), clone 8H3. Western Blot analysis of TBX3 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
TBX3 monoclonal antibody (M02), clone 8H3 Western Blot analysis of TBX3 expression in IMR-32 ( Cat # L008V1 ).
Western Blot (Cell lysate)
TBX3 monoclonal antibody (M02), clone 8H3. Western Blot analysis of TBX3 expression in Raw 264.7 ( Cat # L024V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TBX3 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to TBX3 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TBX3.
Immunogen
TBX3 (NP_005987, 311 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TBX3 monoclonal antibody (M02), clone 8H3. Western Blot analysis of TBX3 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
TBX3 monoclonal antibody (M02), clone 8H3. Western Blot analysis of TBX3 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
TBX3 monoclonal antibody (M02), clone 8H3 Western Blot analysis of TBX3 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Cell lysate)
TBX3 monoclonal antibody (M02), clone 8H3. Western Blot analysis of TBX3 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TBX3 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TBX3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TBX3
Entrez GeneID
6926GeneBank Accession#
NM_005996Protein Accession#
NP_005987Gene Name
TBX3
Gene Alias
TBX3-ISO, UMS, XHL
Gene Description
T-box 3
Gene Ontology
HyperlinkGene Summary
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined. [provided by RefSeq
Other Designations
T-box 3 protein|T-box transcription factor TBX3|bladder cancer related protein XHL
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com