TCEB3 monoclonal antibody (M01), clone 3E2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of TCEB3 expression in transfected 293T cell line by TCEB3 monoclonal antibody (M01), clone 3E2.
Lane 1: TCEB3 transfected lysate(87.2 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TCEB3 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TCEB3.
Immunogen
TCEB3 (NP_003189, 81 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NAEPDEQDFEKSNSRKRPRDALQKEEEMEGDYQETWKATGSRSYSPDHRQKKHRKLSELERPHKVSHGHERRDERKRCHRMSPTYSSDPESSDYGHVQSPPSCTSPHQMY
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TCEB3 expression in transfected 293T cell line by TCEB3 monoclonal antibody (M01), clone 3E2.
Lane 1: TCEB3 transfected lysate(87.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TCEB3 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — TCEB3
Entrez GeneID
6924GeneBank Accession#
NM_003198Protein Accession#
NP_003189Gene Name
TCEB3
Gene Alias
FLJ38760, FLJ42849, SIII, TCEB3A
Gene Description
transcription elongation factor B (SIII), polypeptide 3 (110kDa, elongin A)
Omim ID
600786Gene Ontology
HyperlinkGene Summary
This gene encodes the protein elongin A, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. [provided by RefSeq
Other Designations
OTTHUMP00000002990|elongin A|transcription elongation factor B (SIII), polypeptide 3 (110kD)|transcription elongation factor B alpha subunit
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com