TCEB2 monoclonal antibody (M01), clone 6F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
TCEB2 monoclonal antibody (M01), clone 6F6. Western Blot analysis of TCEB2 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
TCEB2 monoclonal antibody (M01), clone 6F6 Western Blot analysis of TCEB2 expression in Hela S3 NE ( Cat # L013V3 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TCEB2 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to TCEB2 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TCEB2.
Immunogen
TCEB2 (NP_009039, 9 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TCEB2 monoclonal antibody (M01), clone 6F6. Western Blot analysis of TCEB2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
TCEB2 monoclonal antibody (M01), clone 6F6 Western Blot analysis of TCEB2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TCEB2 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TCEB2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TCEB2
Entrez GeneID
6923GeneBank Accession#
NM_007108Protein Accession#
NP_009039Gene Name
TCEB2
Gene Alias
ELOB, SIII
Gene Description
transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B)
Omim ID
600787Gene Ontology
HyperlinkGene Summary
This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. Pseudogenes have been identified on chromosomes 11 and 13. [provided by RefSeq
Other Designations
RNA polymerase II transcription factor SIII p18 subunit|SIII p18|elongin B|elongin, 18-kD subunit|transcription elongation factor B (SIII), polypeptide 2 (18kD, elongin B)
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com