Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TCEB2 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00006923-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human TCEB2 protein.
  • Immunogen:
  • TCEB2 (NP_009039.1, 1 a.a. ~ 118 a.a) full-length human protein.
  • Sequence:
  • MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TCEB2 MaxPab polyclonal antibody. Western Blot analysis of TCEB2 expression in Jurkat.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TCEB2 expression in transfected 293T cell line (H00006923-T01) by TCEB2 MaxPab polyclonal antibody.

    Lane 1: TCEB2 transfected lysate(12.98 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6923
  • Gene Name:
  • TCEB2
  • Gene Alias:
  • ELOB,SIII
  • Gene Description:
  • transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B)
  • Gene Summary:
  • This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. Pseudogenes have been identified on chromosomes 11 and 13. [provided by RefSeq
  • Other Designations:
  • RNA polymerase II transcription factor SIII p18 subunit,SIII p18,elongin B,elongin, 18-kD subunit,transcription elongation factor B (SIII), polypeptide 2 (18kD, elongin B)
  • RSS
  • YouTube
  • Linkedin
  • Facebook