TCEB2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human TCEB2 protein.
Immunogen
TCEB2 (NP_009039.1, 1 a.a. ~ 118 a.a) full-length human protein.
Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TCEB2 MaxPab polyclonal antibody. Western Blot analysis of TCEB2 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of TCEB2 expression in transfected 293T cell line (H00006923-T01) by TCEB2 MaxPab polyclonal antibody.
Lane 1: TCEB2 transfected lysate(12.98 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TCEB2
Entrez GeneID
6923GeneBank Accession#
NM_007108.2Protein Accession#
NP_009039.1Gene Name
TCEB2
Gene Alias
ELOB, SIII
Gene Description
transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B)
Omim ID
600787Gene Ontology
HyperlinkGene Summary
This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. Pseudogenes have been identified on chromosomes 11 and 13. [provided by RefSeq
Other Designations
RNA polymerase II transcription factor SIII p18 subunit|SIII p18|elongin B|elongin, 18-kD subunit|transcription elongation factor B (SIII), polypeptide 2 (18kD, elongin B)
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com