Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TCEB1 polyclonal antibody (A01)

  • Catalog # : H00006921-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant TCEB1.
  • Immunogen:
  • TCEB1 (AAH13809, 1 a.a. ~ 112 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006921-A01
    Western Blot detection against Immunogen (38.43 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6921
  • Gene Name:
  • TCEB1
  • Gene Alias:
  • SIII
  • Gene Description:
  • transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C)
  • Gene Summary:
  • This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. [provided by RefSeq
  • Other Designations:
  • elongin C,transcription elongation factor B (SIII), polypeptide 1 (15kD, elongin C),transcription elongation factor B, polypeptide 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook