TBX5 monoclonal antibody (M01), clone 1G10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TBX5.
Immunogen
TBX5 (AAH27942, 402 a.a. ~ 518 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PSMPSYSSCTVTTVQPMDRLPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGTLQPPEFLYSHGVPRTLSPHQYHSVHGVGMVPEWSDNS
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.61 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TBX5 expression in transfected 293T cell line by TBX5 monoclonal antibody (M01), clone 1G10.
Lane 1: TBX5 transfected lysate(57.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TBX5 over-expressed 293 cell line, cotransfected with TBX5 Validated Chimera RNAi ( Cat # H00006910-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TBX5 monoclonal antibody (M01), clone 1G10 (Cat # H00006910-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — TBX5
Entrez GeneID
6910GeneBank Accession#
BC027942Protein Accession#
AAH27942Gene Name
TBX5
Gene Alias
HOS
Gene Description
T-box 5
Gene Ontology
HyperlinkGene Summary
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
Other Designations
T-box transcription factor TBX5
-
Interactome
-
Disease
-
Publication Reference
-
Human heart-forming organoids recapitulate early heart and foregut development.
Lika Drakhlis, Santoshi Biswanath, Clara-Milena Farr, Victoria Lupanow, Jana Teske, Katharina Ritzenhoff, Annika Franke, Felix Manstein, Emiliano Bolesani, Henning Kempf, Simone Liebscher, Katja Schenke-Layland, Jan Hegermann, Lena Nolte, Heiko Meyer, Jeanne de la Roche, Stefan Thiemann, Christian Wahl-Schott, Ulrich Martin, Robert Zweigerdt.
Nature Biotechnology 2021 Jun; 39(6):737.
Application:Flow Cyt, Human, Human heart-forming organoids.
-
HDAC4 and 5 repression of TBX5 is relieved by protein kinase D1.
Ghosh TK, Aparicio-Sánchez JJ, Buxton S, Brook JD.
Scientific Reports 2019 Nov; 9(1):17992.
Application:WB-Ti, Mouse, Mouse hearts.
-
Holt-Oram syndrome with intermediate atrioventricular canal defect, and aortic coarctation: Functional characterization of a de novo TBX5 mutation.
Baban A, Pitto L, Pulignani S, Cresci M, Mariani L, Gambacciani C, Digilio MC, Pongiglione G, Albanese S.
American Journal of Medical Genetics. Part A 2014 Jun; 164(16):1419.
Application:WB-Ti, Human, Cardiac.
-
Directing cardiomyogenic differentiation of human pluripotent stem cells by plasmid-based transient overexpression of cardiac transcription factors.
Hartung S, Schwanke K, Haase A, David R, Franz WM, Martin U, Zweigerdt R.
Stem Cells and Development 2013 Apr; 22(7):1112.
Application:IF, Human, hCBiPS2.
-
Physical interaction between TBX5 and MEF2C is required for early heart development.
Ghosh TK, Song FF, Packham EA, Buxton S, Robinson TE, Ronksley J, Self T, Bonser AJ, Brook JD.
Molecular and Cellular Biology 2009 Apr; 29(8):2205.
Application:WB-Ce, WB-Tr, Fish, Monkey, COS-7, Zebrafish embryos.
-
Human heart-forming organoids recapitulate early heart and foregut development.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com