TBX2 monoclonal antibody (M01), clone 7G5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TBX2.
Immunogen
TBX2 (NP_005985, 603 a.a. ~ 702 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGLESQRALSPGRESPK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TBX2 monoclonal antibody (M01), clone 7G5 Western Blot analysis of TBX2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of TBX2 expression in transfected 293T cell line by TBX2 monoclonal antibody (M01), clone 7G5.
Lane 1: TBX2 transfected lysate(74.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TBX2 is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TBX2 over-expressed 293 cell line, cotransfected with TBX2 Validated Chimera RNAi ( Cat # H00006909-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TBX2 monoclonal antibody (M01), clone 7G5 (Cat # H00006909-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to TBX2 on HeLa cell. [antibody concentration 30 ug/ml] -
Gene Info — TBX2
Entrez GeneID
6909GeneBank Accession#
NM_005994Protein Accession#
NP_005985Gene Name
TBX2
Gene Alias
FLJ10169
Gene Description
T-box 2
Omim ID
600747Gene Ontology
HyperlinkGene Summary
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene product is the human homolog of mouse Tbx2, and shares strong sequence similarity with Drosophila omb protein. Expression studies indicate that this gene may have a potential role in tumorigenesis as an immortalizing agent. Transcript heterogeneity due to alternative polyadenylation has been noted for this gene. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
-
Publication Reference
-
Three subtypes of lung cancer fibroblasts define distinct therapeutic paradigms.
Haichuan Hu, Zofia Piotrowska, Patricia J Hare, Huidong Chen, Hillary E Mulvey, Aislinn Mayfield, Sundus Noeen, Krystina Kattermann, Max Greenberg, August Williams, Amanda K Riley, Jarad J Wilson, Ying-Qing Mao, Ruo-Pan Huang, Mandeep K Banwait, Jeffrey Ho, Giovanna S Crowther, Lida P Hariri, Rebecca S Heist, David P Kodack, Luca Pinello, Alice T Shaw, Mari Mino-Kenudson, Aaron N Hata, Lecia V Sequist, Cyril H Benes, Matthew J Niederst, Jeffrey A Engelman.
Cancer Cell 2021 Nov; 39(11):1531.
Application:WB-Tr, Human, Patient-derived fibroblasts.
-
Three subtypes of lung cancer fibroblasts define distinct therapeutic paradigms.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com