TBCA monoclonal antibody (M03), clone 1D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of TBCA expression in transfected 293T cell line by TBCA monoclonal antibody (M03), clone 1D2.
Lane 1: TBCA transfected lysate(12.9 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TBCA is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.62 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant TBCA.
Immunogen
TBCA (AAH18210, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMSAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (94)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TBCA expression in transfected 293T cell line by TBCA monoclonal antibody (M03), clone 1D2.
Lane 1: TBCA transfected lysate(12.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TBCA is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — TBCA
Entrez GeneID
6902GeneBank Accession#
BC018210Protein Accession#
AAH18210Gene Name
TBCA
Gene Alias
-
Gene Description
tubulin folding cofactor A
Omim ID
610058Gene Ontology
HyperlinkGene Summary
The product of this gene is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. This gene encodes chaperonin cofactor A. [provided by RefSeq
Other Designations
chaperonin cofactor A|tubulin-specific chaperone a
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com