TAZ monoclonal antibody (M12), clone 1B10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant TAZ.
Immunogen
TAZ (AAH11515, 1 a.a. ~ 262 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWAQAEAGPPGYPCPAGGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWVHIFPEGIGRLIAECHLNPIILPLWHVGEPGDGDREMASGVGGLGLPLVPGCPAPPHVWPSVHCAAGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (54.56 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TAZ monoclonal antibody (M12), clone 1B10. Western Blot analysis of TAZ expression in human kidney.Western Blot (Tissue lysate)
TAZ monoclonal antibody (M12), clone 1B10. Western Blot analysis of TAZ expression in human uterus myoma.Western Blot (Cell lysate)
TAZ monoclonal antibody (M12), clone 1B10. Western Blot analysis of TAZ expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
TAZ monoclonal antibody (M12), clone 1B10 Western Blot analysis of TAZ expression in SW-13 ( Cat # L005V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TAZ is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — TAZ
Entrez GeneID
6901GeneBank Accession#
BC011515Protein Accession#
AAH11515Gene Name
TAZ
Gene Alias
BTHS, CMD3A, EFE, EFE2, FLJ27390, G4.5, LVNCX, Taz1, XAP-2
Gene Description
tafazzin
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternatively spliced transcripts have been described but the full-length nature of all these transcripts is not known. [provided by RefSeq
Other Designations
OTTHUMP00000031946|OTTHUMP00000031947|OTTHUMP00000031948|OTTHUMP00000031949|OTTHUMP00000061673
-
Interactome
-
Disease
-
Publication Reference
-
Involvement of YAP, TAZ and HSP90 in Contact Guidance and Intercellular Junction Formation in Corneal Epithelial Cells.
Raghunathan VK, Dreier B, Morgan JT, Tuyen BC, Rose BW, Reilly CM, Russell P, Murphy CJ.
PLoS One 2014 Oct; 9(10):e109811.
Application:ICC, IHC-P, Human, hTCEpi cells, Corneal epithelium.
-
Substratum stiffness and latrunculin B modulate the gene expression of the mechanotransducers YAP and TAZ in human trabecular meshwork cells.
Thomasy SM, Morgan JT, Wood JA, Murphy CJ, Russell P.
Experimental Eye Research 2013 Aug; 113:66.
Application:WB-Ce, Human, Human trabecular meshwork cells.
-
Role of substratum stiffness in modulating genes associated with extracellular matrix and mechanotransducers YAP and TAZ.
Raghunathan VK, Morgan JT, Dreier B, Reilly CM, Thomasy SM, Wood JA, Ly I, Tuyen BC, Hughbanks M, Murphy CJ, Russell P.
Investigative Ophthalmology & Visual Science 2013 Jan; 54(1):378.
Application:WB, IHC-P, Human, Human trabecular meshwork tissue, HTM631 cells.
-
Involvement of YAP, TAZ and HSP90 in Contact Guidance and Intercellular Junction Formation in Corneal Epithelial Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com