Product Browser

Last updated: 2017/5/28
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CNTN2 polyclonal antibody (A01)

  • Catalog # : H00006900-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CNTN2.
  • Immunogen:
  • CNTN2 (NP_005067, 825 a.a. ~ 923 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SSSEMNVTWEPVQQDMNGILLGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPGNISWTF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006900-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6900
  • Gene Name:
  • CNTN2
  • Gene Alias:
  • AXT,DKFZp781D102,FLJ42746,MGC157722,TAG-1,TAX,TAX1
  • Gene Description:
  • contactin 2 (axonal)
  • Gene Summary:
  • The protein encoded by this gene is a member of the immunoglobulin superfamily. It is a glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein that functions as a cell adhesion molecule. It may play a role in the formation of axon connections in the developing nervous system. It may also be involved in glial tumorigenesis and may provide a potential target for therapeutic intervention. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000035179,axonin-1 cell adhesion molecule,contactin 2,contactin 2 (transiently expressed),transient axonal glycoprotein 1,transiently-expressed axonal glycoprotein
  • RSS
  • YouTube
  • Linkedin
  • Facebook