TAT (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TAT full-length ORF ( AAH20707.1, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDPYMIQMSSKGNLPSILDVHVNVGGRSSVPGKMKGRKARWSVRPSDMAKKTFNPIRAIVDNMKVKPNPNKTMISLSIGELGTLLRGCHCPPLLSCSQAGWRRWQLGVSLSTEHGRITSWLLLCFPPIKRGPYCVWKPAYRP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
42.3
Interspecies Antigen Sequence
Mouse (76); Rat (74)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TAT
Entrez GeneID
6898GeneBank Accession#
BC020707.1Protein Accession#
AAH20707.1Gene Name
TAT
Gene Alias
-
Gene Description
tyrosine aminotransferase
Omim ID
276600Gene Ontology
HyperlinkGene Summary
This nuclear gene encodes a mitochondrial protein tyrosine aminotransferase which is present in the liver and catalyzes the conversion of L-tyrosine into p-hydroxyphenylpyruvate. Mutations in this gene cause tyrosinemia (type II, Richner-Hanhart syndrome), a disorder accompanied by major skin and corneal lesions, with possible mental retardation. A regulator gene for tyrosine aminotransferase is X-linked. [provided by RefSeq
Other Designations
tyrosine aminotransferase, cytosolic
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Cysteine and methionine metabolism
- Isoquinoline alkaloid biosynthesis
- Metabolic pathways
- Novobiocin biosynthesis
- Phenylalanine
- Phenylalanine metabolism
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com