TAF13 monoclonal antibody (M02), clone 2B3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TAF13.
Immunogen
TAF13 (NP_005636.1, 27 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TAF13 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — TAF13
Entrez GeneID
6884GeneBank Accession#
NM_005645Protein Accession#
NP_005636.1Gene Name
TAF13
Gene Alias
MGC22425, TAF2K, TAFII18
Gene Description
TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa
Omim ID
600774Gene Ontology
HyperlinkGene Summary
Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit associated with a subset of TFIID complexes. This subunit interacts with TBP and with two other small subunits of TFIID, TAF10 and TAF11. There is a pseudogene located on chromosome 6. [provided by RefSeq
Other Designations
OTTHUMP00000039344|TATA box binding protein (TBP)-associated factor, RNA polymerase II, K, 18kD|TBP-associated factor 13|transcription initiation factor TFIID 18 kD subunit
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com