TAF12 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TAF12 partial ORF ( AAH11986, 56 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
QVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.29
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TAF12
Entrez GeneID
6883GeneBank Accession#
BC011986Protein Accession#
AAH11986Gene Name
TAF12
Gene Alias
TAF2J, TAFII20
Gene Description
TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
Omim ID
600773Gene Ontology
HyperlinkGene Summary
Control of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins. These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regulatory elements located adjacent to the transcription start site. Some modulators interact directly with the basal complex, whereas others may act as bridging proteins linking transactivators to the basal transcription factors. Some of these associated factors are weakly attached while others are tightly associated with TBP in the TFIID complex. Among the latter are the TAF proteins. Different TAFs are predicted to mediate the function of distinct transcriptional activators for a variety of gene promoters and RNA polymerases. TAF12 interacts directly with TBP as well as with TAF2I. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000003785|OTTHUMP00000003786|TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20 kD|TATA box binding protein (TBP)-associated factor, RNA polymerase II, J, 20kD|transcription initiation factor TFIID 20/15 kDa subunits
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com