TAF11 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TAF11 partial ORF ( NP_005634, 158 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
31.57
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TAF11
Entrez GeneID
6882GeneBank Accession#
NM_005643Protein Accession#
NP_005634Gene Name
TAF11
Gene Alias
MGC:15243, PRO2134, TAF2I, TAFII28
Gene Description
TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 28kDa
Omim ID
600772Gene Ontology
HyperlinkGene Summary
Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit of TFIID that is present in all TFIID complexes and interacts with TBP. This subunit also interacts with another small subunit, TAF13, to form a heterodimer with a structure similar to the histone core structure. [provided by RefSeq
Other Designations
OTTHUMP00000016241|TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 28 kD|TATA box binding protein (TBP)-associated factor, RNA polymerase II, I, 28kD|TBP-associated factor 11|TFIID subunit p30-beta|transcription initiation facto
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com