TAF10 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TAF10 partial ORF ( AAH12088, 76 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
GAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.18
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TAF10
Entrez GeneID
6881GeneBank Accession#
BC012088Protein Accession#
AAH12088Gene Name
TAF10
Gene Alias
TAF2A, TAF2H, TAFII30
Gene Description
TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa
Omim ID
600475Gene Ontology
HyperlinkGene Summary
Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the small subunits of TFIID that is associated with a subset of TFIID complexes. Studies with human and mammalian cells have shown that this subunit is required for transcriptional activation by the estrogen receptor, for progression through the cell cycle, and may also be required for certain cellular differentiation programs. [provided by RefSeq
Other Designations
TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30 kD|TATA box binding protein (TBP)-associated factor, RNA polymerase II, H, 30kD|TBP-related factor 10|transcription initiation factor TFIID 30 kD subunit
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com