TAF7 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TAF7 partial ORF ( AAH32737, 130 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
FIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.08
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TAF7
Entrez GeneID
6879GeneBank Accession#
BC032737Protein Accession#
AAH32737Gene Name
TAF7
Gene Alias
TAF2F, TAFII55
Gene Description
TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
Omim ID
600573Gene Ontology
HyperlinkGene Summary
The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. [provided by RefSeq
Other Designations
OTTHUMP00000160028|TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55 kD|TATA box binding protein (TBP)-associated factor, RNA polymerase II, F, 55kD|TATA box-binding protein-associated factor 2F|TBP-associated factor F|transcrip
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com