Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TAF7 (Human) Recombinant Protein (P01)

  • Catalog # : H00006879-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TAF7 full-length ORF ( NP_005633.2, 1 a.a. - 349 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 66.7
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006879-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6879
  • Gene Name:
  • TAF7
  • Gene Alias:
  • TAF2F,TAFII55
  • Gene Description:
  • TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
  • Gene Summary:
  • The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000160028,TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55 kD,TATA box binding protein (TBP)-associated factor, RNA polymerase II, F, 55kD,TATA box-binding protein-associated factor 2F,TBP-associated factor F,transcrip
  • RSS
  • YouTube
  • Linkedin
  • Facebook