TAF7 MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of TAF7 expression in transfected 293T cell line (H00006879-T01) by TAF7 MaxPab polyclonal antibody.
Lane 1: TAF7 transfected lysate(38.39 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to TAF7 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 ug/ml]
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to TAF7 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human TAF7 protein.
Immunogen
TAF7 (NP_005633.2, 1 a.a. ~ 349 a.a) full-length human protein.
Sequence
MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TAF7 expression in transfected 293T cell line (H00006879-T01) by TAF7 MaxPab polyclonal antibody.
Lane 1: TAF7 transfected lysate(38.39 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to TAF7 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 ug/ml]Immunofluorescence
Immunofluorescence of purified MaxPab antibody to TAF7 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TAF7
Entrez GeneID
6879GeneBank Accession#
NM_005642.2Protein Accession#
NP_005633.2Gene Name
TAF7
Gene Alias
TAF2F, TAFII55
Gene Description
TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
Omim ID
600573Gene Ontology
HyperlinkGene Summary
The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. [provided by RefSeq
Other Designations
OTTHUMP00000160028|TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55 kD|TATA box binding protein (TBP)-associated factor, RNA polymerase II, F, 55kD|TATA box-binding protein-associated factor 2F|TBP-associated factor F|transcrip
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com