TAGLN monoclonal antibody (M03), clone 1C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TAGLN.
Immunogen
TAGLN (NP_001001522, 19 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMF
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.08 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TAGLN is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — TAGLN
Entrez GeneID
6876GeneBank Accession#
NM_001001522Protein Accession#
NP_001001522Gene Name
TAGLN
Gene Alias
DKFZp686P11128, SM22, SMCC, TAGLN1, WS3-10
Gene Description
transgelin
Omim ID
600818Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a transformation and shape-change sensitive actin cross-linking/gelling protein found in fibroblasts and smooth muscle. Its expression is down-regulated in many cell lines, and this down-regulation may be an early and sensitive marker for the onset of transformation. A functional role of this protein is unclear. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
SM22-alpha|transgelin variant 2
-
Interactome
-
Disease
-
Publication Reference
-
Cross-Reacting Antibacterial Auto-Antibodies Are Produced within Coronary Atherosclerotic Plaques of Acute Coronary Syndrome Patients.
Canducci F, Saita D, Foglieni C, Piscopiello MR, Chiesa R, Colombo A, Cianflone D, Maseri A, Clementi M, Burioni R.
PLoS One 2012 Aug; 7(8):e42283.
Application:ELISA, WB-Re, Recombinant protein.
-
Cross-Reacting Antibacterial Auto-Antibodies Are Produced within Coronary Atherosclerotic Plaques of Acute Coronary Syndrome Patients.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com