TAF4 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TAF4 partial ORF ( NP_003176, 715 a.a. - 800 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LQPPVLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNPLQPVPVVKPAVLPGT
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.2
Interspecies Antigen Sequence
Mouse (94)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TAF4
Entrez GeneID
6874GeneBank Accession#
NM_003185Protein Accession#
NP_003176Gene Name
TAF4
Gene Alias
FLJ41943, TAF2C, TAF2C1, TAF4A, TAFII130, TAFII135
Gene Description
TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa
Omim ID
601796Gene Ontology
HyperlinkGene Summary
Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the larger subunits of TFIID that has been shown to potentiate transcriptional activation by retinoic acid, thyroid hormone and vitamin D3 receptors. In addition, this subunit interacts with the transcription factor CREB, which has a glutamine-rich activation domain, and binds to other proteins containing glutamine-rich regions. Aberrant binding to this subunit by proteins with expanded polyglutamine regions has been suggested as one of the pathogenetic mechanisms underlying a group of neurodegenerative disorders referred to as polyglutamine diseases. [provided by RefSeq
Other Designations
TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135 kD|TAF4A RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135 kD|TATA box binding protein (TBP)-associated factor, RNA polymerase II, C1, 130kD|TBP-associate
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com